PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02480.1.p
Common NameEUGRSUZ_K02480, LOC104425980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 480aa    MW: 51614.1 Da    PI: 5.048
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02480.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.8e-39144203261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       ++k+++cprC+s++tkfCyynny+++qPr+fC+aC+ryWt+GG++rnvPvG+grrknk++
  Eucgr.K02480.1.p 144 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCRACQRYWTAGGTMRNVPVGAGRRKNKNA 203
                       7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-31132201IPR003851Zinc finger, Dof-type
PfamPF027014.2E-32146202IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.63148202IPR003851Zinc finger, Dof-type
PROSITE patternPS013610150186IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MQETQDPAIK LFGAKIPVSS AADGAALAAA KPEEREDGGG GGGGGGEEEY DEDEGGGGGE  60
EQEIEDAEQF QNASPEKASE NMQEDCEPPP NSQELDPSRT SPDAVNPMTP SIQEESTTSH  120
ITETGAQEEH GTPKNSQDKT LKKPDKIIPC PRCNSMDTKF CYYNNYNVNQ PRHFCRACQR  180
YWTAGGTMRN VPVGAGRRKN KNAATRYRPI TISEALQAAR VDSPNGAQLP HLRTNGAVLT  240
FGLDSPVCNS QSPIPNISEK KKVLNGYKNG FRDIENGDDS STSSSVTISN SMNEKGLNFP  300
QEQGMGNVNG FSTQIPCLPG VPWPYPWNST IPSPAFCPSG CPPMSFYPAA FWACGVLPNA  360
WNIPCMSPQS PFCNQKATTS GPNAPTLGKH SRESEPLKSD ISLEQAEPPR QKNGSILVPK  420
TLRIDDPSEA AKSSIWAALG IKAFEPKSRE GKVKDAETLP HLHANPAALS RSLNFHENT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02480.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037173.10.0PREDICTED: cyclic dof factor 3-like isoform X1
TrEMBLA0A059A6740.0A0A059A674_EUCGR; Uncharacterized protein
STRINGGLYMA17G10920.31e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54412848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-96cycling DOF factor 3